missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BCL7B Partial ORF (NP_001698, 124 a.a. - 202 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009275-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100326

  • 518.16 € / 25µg

Estimated Shipment: 21-01-2022
Add to basket

Description

Description

The protein encoded by this gene contains a region that is highly similar to the N-terminal segment of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. This gene is located at a chromosomal region commonly deleted in Williams syndrome. The function of this gene has not yet been determined. [provided by RefSeq]

Sequence: AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
Specifications

Specifications

NP_001698
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.43kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
RUO
BCL7B
Yes
wheat germ expression system
Liquid
9275
BCL7B (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BCL7B
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Promotions

Promotions