missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BBS1 Partial ORF (NP_078925, 187 a.a. - 295 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00000582-Q01.10ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16185154

  • 310.00 € / 10 Mikrogramm


Verfügbar ab
23-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Mutations in this gene have been observed in patients with the major form (type 1) of Bardet-Biedl syndrome. The encoded protein may play a role in eye, limb, cardiac and reproductive system development. [provided by RefSeq]

Sequence: NQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGL
Spezifikation

Spezifikation

NP_078925
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGL
RUO
BBS1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
582
BBS1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BBS2L2|FLJ23590|MGC126183|MGC126184|MGC51114
BBS1
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation