missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARL6IP6 Full-length ORF (NP_689735.1, 1 a.a. - 226 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00151188-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138653

  • 508.00 € / 25µg
Estimated Shipment: 21-08-2024
to see stock.

Description

Description

Sequence: MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFPAAAGSRAQPRRWPVQVLSILCSLLFAILLAFLLAIAYLIVKELHAENLKNEDDVDTGLLGFWTLLIISLTAGFSCCSFSWTVTYFDSFEPGMFPPTPLSPARFKKLTGHSFHMGYSMAILNGIVAALTVAWCLM
Specifications

Specifications

NP_689735.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
51.1kDa
Glutathione Sepharose 4 Fast Flow
25 ug
RUO
ARL6IP6
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, Protein Array, ELISA, Western Blot
151188
ARL6IP6 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC33864/PFAAP1
ARL6IP6
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions