missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARID5B Partial ORF (XP_084482, 1483 a.a. - 1582 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00084159-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100657

  • 518.16 € / 25µg

Estimated Shipment: 30-12-2021
Add to basket

Description

Description

Sequence: SGLNSRLPAGYSHSLQYLKNQTVLSPLMQPLAFHSLVMQRGIFTSPTNSQQLYRHLAAATPVGSSYGDLLHNSIYPLAAINPQAAFPSSQLSSVHPSTKL
Specifications

Specifications

XP_084482
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue
SGLNSRLPAGYSHSLQYLKNQTVLSPLMQPLAFHSLVMQRGIFTSPTNSQQLYRHLAAATPVGSSYGDLLHNSIYPLAAINPQAAFPSSQLSSVHPSTKL
RUO
ARID5B
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
84159
ARID5B (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DESRT/FLJ21150/MRF2
ARID5B
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions