missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human APBB1IP Full-length ORF (AAH35636, 1 a.a. - 172 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00054518-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100613

  • 341.70 € / 10µg

Estimated Shipment: 30-12-2021
Add to basket

Description

Description

Sequence: MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLSQVSMWDQRWQDHQPLLPITDVP
Specifications

Specifications

AAH35636
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
44.66kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
APBB1IP
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
54518
APBB1IP (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
INAG1/PREL1/RARP1/RIAM
APBB1IP
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions