missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ALPK2 Partial ORF (NP_443179, 201 a.a. - 309 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00115701-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16101497

  • 518.16 € / 25µg

Estimated Shipment: 23-12-2021
Add to basket

Description

Description

Sequence: DGTSSVTEQGRYKLPTAPEAAENDYPGIQGETRDSHQAREEFASDNLLNMDESVRETEMKLLSGESENSGMSQCWETAADKRVGGKDLWSKRGSRKSARVRQPGMKGNP
Specifications

Specifications

NP_443179
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DGTSSVTEQGRYKLPTAPEAAENDYPGIQGETRDSHQAREEFASDNLLNMDESVRETEMKLLSGESENSGMSQCWETAADKRVGGKDLWSKRGSRKSARVRQPGMKGNP
RUO
ALPK2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
115701
ALPK2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ34875/FLJ43253/HAK
ALPK2
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions