missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ADCK2 Partial ORF (AAH14107.1, 2 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00090956-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16101137

  • 341.70 € / 10µg

Estimated Shipment: 23-12-2021
Add to basket

Description

Description

Sequence: VAPWRVSVRVCLSHLRCFELRQGLSLLRPSECPRDARLCWLLLGTLPKVVSLCGDVGEGAPDVLSRRRVRCSGAAGAGPAESLPRAGPL
Specifications

Specifications

AAH14107.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.53kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VAPWRVSVRVCLSHLRCFELRQGLSLLRPSECPRDARLCWLLLGTLPKVVSLCGDVGEGAPDVLSRRRVRCSGAAGAGPAESLPRAGPL
RUO
ADCK2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
90956
ADCK2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AARF/MGC20727
ADCK2
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions