missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ACSL4 Partial ORF (NP_004449.1, 581 a.a. - 670 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002182-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16073975

  • 341.70 € / 10µg

Estimated Shipment: 23-12-2021
Add to basket

Description

Description

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq]

Sequence: RLTLLAQQKGVEGTWVDICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMYGGK
Specifications

Specifications

NP_004449.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RLTLLAQQKGVEGTWVDICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMYGGK
RUO
ACSL4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2182
ACSL4 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ACS4/FACL4/LACS4/MRX63/MRX68
ACSL4
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions