missing translation for 'onlineSavingsMsg'
Learn More

GCG Recombinant Protein, Abnova

Human GCG full-length ORF recombinant protein with GST-tag at N-terminal

Marke:  Abnova H00002641-P01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16185361

  • 467.00 € / 25 Mikrogramm


Verfügbar ab
15-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signaling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

  • Theoretical MW (kDa): 45.54
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spezifikation

Spezifikation

Antibody Production, ELISA, Protein Array, Western Blotting (Recombinant Protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Human GCG Full-length ORF Recombinant Protein with GST-tag at N-terminal
In vitro wheat germ expression system
12.5% SDS-PAGE stained with Coomassie Blue
Wheat Germ (in vitro)
Human
Solution
45.54
8
Glutathione Sepharose 4 Fast Flow
25μg
-80°C
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation