missing translation for 'onlineSavingsMsg'
Learn More

FANCL Recombinant Protein, Abnova

Brand:  Abnova H00055120-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16101143

  • 341.70 € / 10µg

Estimated Shipment: 24-01-2022
Add to basket

Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH54517
Solution
55120
FANCL (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FANCL
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
66.99
8
Glutathione Sepharose 4 Fast Flow
10 ug
MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADRVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNVIFGECPYCSKPITLKMSGRKH
FAAP43/FLJ10335/PHF9/POG
FANCL
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Promotions

Promotions