missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FANCL Recombinant Protein

335.00 € - 508.00 €

Accession Number	AAH54517
For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez)	55120
Molecular Weight (g/mol)	66.99

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16101143 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00055120-P01.10UG	10 ug	335.00 € 10µg View alternative products Save Up to »	Estimated Shipment: 31-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

16111143 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00055120-P01.25UG	25 ug	508.00 € 25µg View alternative products missing translation for 'toSaveUpto' »	Estimated Shipment: 31-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH54517
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	66.99
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	FANCL
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	55120
Name	FANCL (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADRVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNVIFGECPYCSKPITLKMSGRKH
Gene Alias	FAAP43/FLJ10335/PHF9/POG
Gene Symbol	FANCL
Species	Wheat Germ (in vitro)
Protein Tag	GST

Description