missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ FABP5 Recombinant Protein
Human FABP5 full-length ORF recombinant protein with GST-tag at N-terminal
335.00 € - 508.00 €
Specifications
| Accession Number | AAH19385 |
|---|---|
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Gene ID (Entrez) | 2171 |
| Molecular Weight (g/mol) | 40.59 |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16184801
|
Abnova™
H00002171-P01.10UG |
10 ug |
335.00 €
10µg |
Estimated Shipment: 31-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16194801
|
Abnova™
H00002171-P01.25UG |
25 ug |
508.00 €
25µg |
Estimated Shipment: 31-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. The human genome contains many pseudogenes similar to this locus.
- Molecular Weight: 40.59kDa
- Preparation Method: in vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8.0 in the elution buffer
Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRITQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
| AAH19385 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 40.59 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FABP5 | |
| Human | |
| Recombinant | |
| Solution |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 2171 | |
| FABP5 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRITQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE | |
| E-FABP/EFABP/PA-FABP/PAFABP | |
| FABP5 | |
| Wheat Germ (in vitro) | |
| GST |