missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CLTB (Human) Recombinant Protein

Human CLTB full-length ORF ( AAH06457, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00001212-P01.10ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16183321

  • 310.00 € / 10 Mikrogramm


Verfügbar ab
16-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

  • Sequence: MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Spezifikation

Spezifikation

AAH06457
clathrin, light chain (Lcb)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CLTB
GST
1212
Wheat germ expression system
10 μg
LCB
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation