missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CD40 (Human) Recombinant Protein
Human CD40 full-length ORF ( NP_001241, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.
335.00 € - 508.00 €
Specifications
| Accession Number | NP_001241 |
|---|---|
| Gene ID (Entrez) | 958 |
| Name | CD40 molecule, TNF receptor superfamily member 5 |
| Preparation Method | Wheat germ expression system |
| Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16185934
|
Abnova™
H00000958-P02.10UG |
10 μg |
335.00 €
10µg |
Estimated Shipment: 31-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16195934
|
Abnova™
H00000958-P02.25UG |
25 μg |
508.00 €
25µg |
Estimated Shipment: 31-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
- Sequence: MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Specifications
| NP_001241 | |
| CD40 molecule, TNF receptor superfamily member 5 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Bp50, CDW40, MGC9013, TNFRSF5, p50 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 958 | |
| Wheat germ expression system | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CD40 | |
| GST |