missing translation for 'onlineSavingsMsg'
Learn More

pyruvate dehydrogenase kinase, isozyme 3, Mouse, Clone: 3A1, Abnova™

Name: pyruvate dehydrogenase kinase, isozyme 3, Mouse, Clone: 3A1, Abnova&trade;
Brand: Abnova
SKU: 16162575
Price: 326.00 EUR

Mouse monoclonal antibody raised against a partial recombinant PDK3.

Brand: Abnova H00005165-M02.100ug

Additional Details : Weight : 0.00010kg

Product Code. 16162575

Estimated Shipment: 14-05-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: GDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDR

Specifications

Antigen	pyruvate dehydrogenase kinase, isozyme 3
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	BC015948
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	5165
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG1 κ

Applications	ELISA, Western Blot
Clone	3A1
Description	Mouse monoclonal antibody raised against a partial recombinant PDK3.
Gene	PDK3
Gene Symbols	PDK3
Immunogen	PDK3 (AAH15948, 174 a.a. ∼ 263 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Research Discipline	Kinases
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Product Suggestions

Description