missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MARVELD2 Antibody [Alexa Fluor« 405], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35481AF405
This item is not returnable.
View return policy
Description
MARVELD2 Polyclonal antibody specifically detects MARVELD2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| MARVELD2 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 153562 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Western Blot | |
| Alexa Fluor 405 | |
| MARVEL domain containing 2, MRVLDC2, TRICautosomal recessive 49 | |
| A synthetic peptide corresponding to a sequence within amino acids 200-300 of human MARVELD2 (NP_001033692.2).,, Sequence:, ELLLGAGVFACVTAYIHKDSEWYNLFGYSQPYGMGGVGGLGSMYGGYYYTGPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction