missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KiSS1R/GPR54 Antibody [Allophycocyanin], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38024APC
This item is not returnable.
View return policy
Description
KiSS1R/GPR54 Polyclonal antibody specifically detects KiSS1R/GPR54 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
| KiSS1R/GPR54 | |
| Polyclonal | |
| PBS | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| APC | |
| AXOR12hypogonadotropin-1, G protein-coupled receptor 54, GPR54kiSS-1R, G-protein coupled receptor 54, G-protein coupled receptor OT7T175, HOT7T175, Hypogonadotropin-1, kiSS-1 receptor, KISS1 receptor, KiSS-1R, Kisspeptins receptor, Metastin receptor | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KiSS1R/GPR54 (NP_115940.2).,, Sequence:, SYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPHAELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL | |
| 0.1 mL | |
| GPCR | |
| 84634 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction