missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CPT2 Antibody [Janelia Fluor« 646], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38018JF646
This item is not returnable.
View return policy
Description
CPT2 Polyclonal antibody specifically detects CPT2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
| CPT2 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Janelia Fluor 646 | |
| carnitine O-palmitoyltransferase 2, mitochondrial, carnitine palmitoyltransferase 2, Carnitine palmitoyltransferase IIEC 2.3.1.21, CPT II, CPT1, CPTASE | |
| A synthetic peptide corresponding to a sequence within amino acids 420-658 of human CPT2 (NP_000089.1).,, Sequence:, VALDKQNKHTSYISGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNPAKSDTITFKRLIRFVPSSLS | |
| 0.1 mL | |
| Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction | |
| 1376 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction