missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EAAT3 Antibody [Alexa Fluor« 647], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38021AF647
This item is not returnable.
View return policy
Description
EAAT3 Polyclonal antibody specifically detects EAAT3 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
| EAAT3 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Alexa Fluor 647 | |
| EAAC1excitatory amino acid carrier 1, EAAT3excitatory amino acid transporter 3, Excitatory amino-acid carrier 1, Neuronal and epithelial glutamate transporter, Sodium-dependent glutamate/aspartate transporter 3, solute carrier family 1 (neuronal/epithelial high affinity glutamatetransporter, system Xag), member 1, Solute carrier family 1 member 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 430-524 of human EAAT3 (NP_004161.4).,, Sequence:, SIKPGVTQKVGEIARTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAISKNKTKEYKIVG | |
| 0.1 mL | |
| ABC Transporters, Cell Biology, Cell Cycle and Replication, Neuronal Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction | |
| 6505 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction