missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SEC61B Antibody [PerCP], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37978PCP
This item is not returnable.
View return policy
Description
SEC61B Polyclonal antibody specifically detects SEC61B in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
| SEC61B | |
| Polyclonal | |
| PBS | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| PerCP | |
| protein translocation complex beta, protein transport protein SEC61 beta subunit, protein transport protein Sec61 subunit beta, Sec61 beta subunit, Sec61 complex, beta subunit, SEC61B | |
| A synthetic peptide corresponding to a sequence within amino acids 1-96 of human SEC61B (NP_006799.1).,, Sequence:, MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS | |
| 0.1 mL | |
| Membrane Trafficking and Chaperones | |
| 10952 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction