missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MYF6 Antibody [PerCP], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35524PCP
This item is not returnable.
View return policy
Description
MYF6 Polyclonal antibody specifically detects MYF6 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| MYF6 | |
| Polyclonal | |
| PBS | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 4618 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Western Blot | |
| PerCP | |
| bHLHc4BHLHC4, Class C basic helix-loop-helix protein 4, MRF4, MRF4myogenic factor 6, Muscle-specific regulatory factor 4, Myf-6, myogenic factor 6 (herculin) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human MYF6 (NP_002460.1).,, Sequence:, WACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFL | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction