missing translation for 'onlineSavingsMsg'
Learn More

CaM Kinase II gamma Antibody [DyLight 350], Novus Biologicals Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-37964UV

Product Code. 30500577

682.00 € / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

CaM Kinase II gamma Polyclonal antibody specifically detects CaM Kinase II gamma in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence

Specifications

Antigen	CaM Kinase II gamma
Classification	Polyclonal
Formulation	50mM Sodium Borate
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Product Type	Antibody
Isotype	IgG

Applications	ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Conjugate	DyLight 350
Gene Alias	calcium/calmodulin-dependent protein kinase (CaM kinase) II gamma, calcium/calmodulin-dependent protein kinase II gamma, calcium/calmodulin-dependent protein kinase type II subunit gamma, CaM kinase II subunit gamma, CAMK, CAMKGFLJ16043, CAMK-II, CaMK-II subunit gamma, EC 2.7.11, EC 2.7.11.17, MGC26678
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 300-410 of human CaM Kinase II gamma (NP_751909.1).,, Sequence:, LKGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVHLMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAI
Quantity	0.1 mL
Research Discipline	Protein Kinase, Signal Transduction, Tyrosine Kinases, Wnt Signaling Pathway
Gene ID (Entrez)	818
Content And Storage	Store at 4°C in the dark.
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

CaM Kinase II gamma Antibody [DyLight 350], Novus Biologicals Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions