missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ILF1 Antibody [Alexa Fluor« 647], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35424AF647
This item is not returnable.
View return policy
Description
ILF1 Polyclonal antibody specifically detects ILF1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| ILF1 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| Alexa Fluor 647 | |
| Cellular transcription factor ILF-1, forkhead box K2, forkhead box protein K2, FOXK1, ILF-1, ILF1ILF, interleukin enhancer binding factor 1, Interleukin enhancer-binding factor 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 360-430 of human ILF1 (NP_004505.2).,, Sequence:, TPLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLEPEPGAAQPKLAVIQEARFAQSAPGSPL | |
| 0.1 mL | |
| Immunology, Innate Immunity | |
| 3607 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction