missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Acidic Calponin Antibody [Janelia Fluor« 549], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37886JF549
This item is not returnable.
View return policy
Description
Acidic Calponin Polyclonal antibody specifically detects Acidic Calponin in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
| Acidic Calponin | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 1266 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Janelia Fluor 549 | |
| calponin 3, acidic, Calponin, acidic isoform, calponin-3, dJ639P13.2.2 (acidic calponin 3) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 220-329 of human Acidic Calponin (NP_001830.1).,, Sequence:, LAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction