missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRMP1 Antibody [DyLight 755], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38009IR
This item is not returnable.
View return policy
Description
CRMP1 Polyclonal antibody specifically detects CRMP1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
| CRMP1 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| DyLight 755 | |
| collapsin response mediator protein 1DRP1, CRMP-1, dihydropyrimidinase-like 1, dihydropyrimidinase-related protein 1, DPYSL1DRP-1dihydropyrimidinase related protein-1, ULIP3, ULIP-3, Unc-33-like phosphoprotein 3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 460-540 of human CRMP1 (NP_001304.1).,, Sequence:, NVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFS | |
| 0.1 mL | |
| Neuroscience | |
| 1400 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction