missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NCF4 Antibody [DyLight 488], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37904G
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
NCF4 Polyclonal antibody specifically detects NCF4 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Spécification
| NCF4 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| DyLight 488 | |
| MGC3810, NCF, NCF-4, neutrophil cytosol factor 4, neutrophil cytosolic factor 4 (40kD), neutrophil cytosolic factor 4, 40kDa, Neutrophil NADPH oxidase factor 4, p40phox, p40-phox, SH3 and PX domain-containing protein 4, SH3PXD4P40PHOX | |
| A synthetic peptide corresponding to a sequence within amino acids 1-190 of human NCF4 (NP_038202.2).,, Sequence:, EIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLL | |
| 0.1 mL | |
| Signal Transduction | |
| 4689 | |
| Store at 4°C in the dark. | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu