missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MEIS1 Antibody [Alexa Fluor« 405], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35814AF405
This item is not returnable.
View return policy
Description
MEIS1 Polyclonal antibody specifically detects MEIS1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
| MEIS1 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 4211 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Alexa Fluor 405 | |
| homeobox protein Meis1, leukemogenic homolog protein, Meis homeobox 1, MGC43380, myeloid ecotropic viral integration site 1 homolog, myeloid ecotropic viral integration site 1 homolog (mouse) | |
| A synthetic peptide corresponding to a sequence within amino acids 300-390 of human MEIS1 (NP_002389.1).,, Sequence:, PSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction