missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Protein Phosphatase 1 beta Antibody [Janelia Fluor« 646], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35163JF646
This item is not returnable.
View return policy
Description
Protein Phosphatase 1 beta Polyclonal antibody specifically detects Protein Phosphatase 1 beta in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
| Protein Phosphatase 1 beta | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Janelia Fluor 646 | |
| EC 3.1.3.16, EC 3.1.3.53, MGC3672, PP1beta, PP-1Bprotein phosphatase 1, catalytic subunit, delta isoform, PPP1CD, protein phosphatase 1, catalytic subunit, beta isoform, protein phosphatase 1, catalytic subunit, beta isozyme, protein phosphatase 1-beta, protein phosphatase 1-delta, serine/threonine protein phosphatase PP1-beta catalytic subunit, serine/threonine-protein phosphatase PP1-beta catalytic subunit | |
| A synthetic peptide corresponding to a sequence within amino acids 227-327 of human Protein Phosphatase 1 beta (NP_002700.1).,, Sequence:, GADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR | |
| 0.1 mL | |
| Cancer, Lipid and Metabolism, Protein Phosphatase | |
| 5500 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction