missing translation for 'onlineSavingsMsg'
Learn More
Learn More
G gamma7 Antibody [Alexa Fluor« 488], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35093AF488
This item is not returnable.
View return policy
Description
G gamma7 Polyclonal antibody specifically detects G gamma7 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| G gamma7 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 2788 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Western Blot | |
| Alexa Fluor 488 | |
| FLJ00058, GNGT7, guanine nucleotide binding protein (G protein), gamma 7, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human G gamma7 (NP_443079.1).,, Sequence:, MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL | |
| 0.1 mL | |
| Primary | |
| Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction