missing translation for 'onlineSavingsMsg'
Learn More
Learn More
REEP5 Antibody [DyLight 755], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35088IR
This item is not returnable.
View return policy
Description
REEP5 Polyclonal antibody specifically detects REEP5 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| REEP5 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 7905 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Western Blot | |
| DyLight 755 | |
| C5orf18polyposis coli region hypothetical protein DP1, chromosome 5 open reading frame 18, D5S346deleted in polyposis 1, DP1TB2YOP1, MGC70440, Polyposis locus protein 1, Protein TB2, receptor accessory protein 5, receptor expression enhancing protein 5, receptor expression-enhancing protein 5 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 120-189 of human REEP5 (NP_005660.4).,, Sequence:, FLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction