missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DHX38 Antibody [PerCP], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38087PCP
This item is not returnable.
View return policy
Description
DHX38 Polyclonal antibody specifically detects DHX38 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| DHX38 | |
| Polyclonal | |
| PBS | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 9785 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Western Blot | |
| PerCP | |
| ATP-dependent RNA helicase DHX38, DDX38pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 38, DEAH (Asp-Glu-Ala-His) box polypeptide 38, DEAH box protein 38, EC 3.6.1, EC 3.6.4.13, KIAA0224pre-mRNA splicing factor ATP-dependent RNA helicase PRP16, PRP16 homolog of S.cerevisiae, PRP16hPrp16, PRPF16 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1133-1227 of human DHX38 (NP_054722.2).,, Sequence:, VTAVDGEWLAELGPMFYSVKQAGKSRQENRRRAKEEASAMEEEMALAEEQLRARRQEQEKRSPLGSVRSTKIYTPGRKEQGEPMTPRRTPARFGL | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction