missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Caspase-4 Antibody [DyLight 350], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35895UV
This item is not returnable.
View return policy
Description
Caspase-4 Polyclonal antibody specifically detects Caspase-4 in Human samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
| Caspase-4 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| DyLight 350 | |
| apoptotic cysteine protease Mih1/TX, CASP-4, caspase 4, apoptosis-related cysteine peptidase, caspase 4, apoptosis-related cysteine protease, caspase-4, EC 3.4.22, EC 3.4.22.57, ICE(rel)II, ICE(rel)-II, ICEREL-II, ICH2, ICH-2, Mih1/TX, Protease ICH-2, Protease TX, TX | |
| A synthetic peptide corresponding to a sequence within amino acids 81-270 of human Caspase-4 (NP_001216.1).,, Sequence:, SDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF | |
| 0.1 mL | |
| Apoptosis, Cancer, Caspases | |
| 837 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction