missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF331 Antibody [DyLight 650], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35559C
This item is not returnable.
View return policy
Description
ZNF331 Polyclonal antibody specifically detects ZNF331 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| ZNF331 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 55422 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Western Blot | |
| DyLight 650 | |
| ZFN533, zinc finger protein 385B, Zinc finger protein 533FLJ25270, ZNF533 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human ZNF331 (NP_061025.5).,, Sequence:, AYENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENS | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction