missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Calmodulin Antibody [DyLight 488], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35196G
This item is not returnable.
View return policy
Description
Calmodulin Polyclonal antibody specifically detects Calmodulin in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Calmodulin | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| DyLight 488 | |
| CALM, CALM2, CALM3, CALML2, calmodulin, calmodulin 1 (phosphorylase kinase, delta), CaM, CAM1, CAM2, CAM3, CAMB, CAMC, CAMI, CAMIII, DD132, PHKDCAM, phosphorylase kinase, delta subunit | |
| A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin (NP_008819.1).,, Sequence:, LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK | |
| 0.1 mL | |
| Cell Cycle and Replication, Neuroscience, Neurotransmission, Signal Transduction | |
| 801 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction