missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NCBP1 Antibody [Alexa Fluor« 700], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35402AF700
This item is not returnable.
View return policy
Description
NCBP1 Polyclonal antibody specifically detects NCBP1 in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
| NCBP1 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 4686 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Alexa Fluor 700 | |
| CBP80nuclear cap binding protein subunit 1, 80kD, NCBP 80 kDa subunit, NCBPMGC2087, nuclear cap binding protein subunit 1, 80kDa, nuclear cap-binding protein subunit 1,80 kDa nuclear cap-binding protein, Sto1 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NCBP1 (NP_002477.1).,, Sequence:, MSRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNF | |
| 0.1 mL | |
| Primary | |
| Human, Mouse | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction