missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ELOVL6 Antibody [Janelia Fluor« 549], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37909JF549
This item is not returnable.
View return policy
Description
ELOVL6 Polyclonal antibody specifically detects ELOVL6 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| ELOVL6 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| Janelia Fluor 549 | |
| elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast), ELOVL fatty acid elongase 6,3-keto acyl-CoA synthase ELOVL6, FAE, fatty acid elongase 2, long-chain fatty-acyl elongase | |
| A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ELOVL6 (NP_076995.1).,, Sequence:, LMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLL | |
| 0.1 mL | |
| metabolism | |
| 79071 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction