missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MNK1 Antibody [Alexa Fluor« 532], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35840AF532
This item is not returnable.
View return policy
Description
MNK1 Polyclonal antibody specifically detects MNK1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
| MNK1 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Alexa Fluor 532 | |
| EC 2.7.11, EC 2.7.11.1, MAP kinase interacting kinase 1, MAP kinase interacting serine/threonine kinase 1, MAP kinase signal-integrating kinase 1, MAP kinase-interacting serine/threonine-protein kinase 1, Mnk1, MNK1MAP kinase-interacting serine/threonine kinase 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 374-465 of human MNK1 (NP_003675.2).,, Sequence:, VQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL | |
| 0.1 mL | |
| Phospho Specific, Protein Kinase | |
| 8569 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction