missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAJC19 Antibody [Alexa Fluor« 405], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35489AF405
This item is not returnable.
View return policy
Description
DNAJC19 Polyclonal antibody specifically detects DNAJC19 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
| DNAJC19 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Alexa Fluor 405 | |
| DnaJ (Hsp40) homolog, subfamily C, member 19, DnaJ homolog subfamily C member 19, homolog of yeast TIM14, mitochondrial import inner membrane translocase subunit TIM14, Tim14, TIMM14TIM14Pam18 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DNAJC19 (NP_660304.1).,, Sequence:, MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK | |
| 0.1 mL | |
| Vision | |
| 131118 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction