missing translation for 'onlineSavingsMsg'
Learn More
Learn More
![GEMIN2 Antibody [DyLight 680], Novus Biologicals Biologicals 0.1 mL; DyLight](https://assets.fishersci.com/TFS-Assets/CCG/Novus-Biologicals/antibodies/CD45-Antibody-(30-F11)-DyLight-755-Product-Image-NB100-77417IR-img0001.jpg-650.jpg)
GEMIN2 Antibody [DyLight 680], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38028FR
This item is not returnable.
View return policy
Description
GEMIN2 Polyclonal antibody specifically detects GEMIN2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
| GEMIN2 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| DyLight 680 | |
| Component of gems 2, Gemin-2, GEMIN2survival of motor neuron protein-interacting protein 1, SIP1-delta, SMN interacting protein 1-delta, SMN-interacting protein 1, survival of motor neuron protein interacting protein 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 180-280 of human GEMIN2 (NP_003607.1),, Sequence:, LSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS | |
| 0.1 mL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 8487 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido