missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DAZL Antibody [Janelia Fluor« 525], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35406JF525
This item is not returnable.
View return policy
Description
DAZL Polyclonal antibody specifically detects DAZL in Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
| DAZL | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 1618 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Janelia Fluor 525 | |
| DAZHSPGY-like-autosomal, DAZL1DAZ-like autosomal, DAZLA, deleted in azoospermia-like, Deleted in azoospermia-like 1, germline specific RNA binding protein, MGC26406, spermatogenesis gene on the Y-like autosomal, SPGYLADAZ homolog | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 200-250 of human DAZL (NP_001342.2).,, Sequence:, RSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR | |
| 0.1 mL | |
| Primary | |
| Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction