missing translation for 'onlineSavingsMsg'
Learn More
Learn More
USP18 Antibody [DyLight 405], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35697V
This item is not returnable.
View return policy
Description
USP18 Polyclonal antibody specifically detects USP18 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
| USP18 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| DyLight 405 | |
| EC 3.1.2.15, EC 3.4.19.-, hUBP43, ISG15-specific-processing protease, ISG43UBP43, ubiquitin specific peptidase 18, ubiquitin specific protease 18, ubl carboxyl-terminal hydrolase 18, ubl thioesterase 18,43 kDa ISG15-specific protease, Ubl thiolesterase 18 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP18 (NP_059110.2).,, Sequence:, DVDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGG | |
| 0.1 mL | |
| Cell Biology, Neuroscience, Ubiquitin Proteasome Pathway | |
| 11274 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction