missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IP3R1 Antibody [Janelia Fluor« 525], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP3-37937JF525
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
IP3R1 Polyclonal antibody specifically detects IP3R1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry/ Immunofluorescence
Spezifikation
| IP3R1 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Immunoprecipitation, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Janelia Fluor 525 | |
| DKFZp313E1334, DKFZp313N1434, inositol 14,5-triphosphate receptor, type 1, inositol 14,5-trisphosphate receptor type 1, INSP3R1, IP3 receptor, IP3 receptor isoform 1, IP3R, IP3R 1, IP3R1, SCA15, SCA16, spinocerebellar ataxia 15, spinocerebellar ataxia 16, Type 1 inositol 14,5-trisphosphate receptor, Type 1 InsP3 receptor | |
| A synthetic peptide corresponding to a sequence within amino acids 1812-1911 of human IP3R1 (NP_001365381).,, Sequence:, SFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQP | |
| 0.1 mL | |
| Neuroscience | |
| 3708 | |
| Store at 4°C in the dark. | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur