missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GADD45G Antibody [Janelia Fluor« 525], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35120JF525
This item is not returnable.
View return policy
Description
GADD45G Polyclonal antibody specifically detects GADD45G in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| GADD45G | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| Janelia Fluor 525 | |
| CR6DNA damage-inducible transcript 2 protein, Cytokine-responsive protein CR6, DDIT-2, DDIT2GADD45-gamma, growth arrest and DNA damage-inducible protein GADD45 gamma, growth arrest and DNA-damage-inducible, gamma, GRP1717 kD | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 90-159 of human GADD45G (NP_006696.1).,, Sequence:, IDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE | |
| 0.1 mL | |
| Apoptosis, Cancer | |
| 10912 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction