missing translation for 'onlineSavingsMsg'
Learn More

CYP7B1 Antibody [HRP], Novus Biologicals Biologicals™

Product Code. 30498785 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30498785 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30498785 Supplier Novus Biologicals Supplier No. NBP335797H

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

CYP7B1 Polyclonal antibody specifically detects CYP7B1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen CYP7B1
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate HRP
Formulation PBS
Gene Alias CBAS3, CP7B, Cytochrome P450 7B1, cytochrome P450, family 7, subfamily B, polypeptide 1, cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1,25-hydroxycholesterol 7-alpha-hydroxylase, EC 1.14.13.100, oxysterol 7alpha-hydroxylase, Oxysterol 7-alpha-hydroxylase, spastic paraplegia 5A (autosomal recessive), SPG5A
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYP7B1 (NP_004811.1).,, Sequence:, VIVCDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHHLGFLWASVANTIPT
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Cardiovascular Biology, Cellular Signaling, metabolism, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 9420
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.